Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDFIP2 Peptide - middle region

NDFIP2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25842, KIAA1165, N4wbp5a, N4WBP5A

UniProt

Q9NV92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDFIP2 Rabbit Polyclonal Antibody (orb580736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061953

Preservative

Lyophilized powder

AA Sequence

SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P13 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV777465 1.0 µg DNA

RPL21P13 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ILT5 (Immunoglobulin-like Transcript 5)
216629 100 µg

ILT5 (Immunoglobulin-like Transcript 5)

Sign In for Pricing
View Details
MAGEL2 Rabbit Polyclonal Antibody
orb1879590-01 30 µL

MAGEL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGEL2 Rabbit Polyclonal Antibody
orb1879590-02 50 µL

MAGEL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGEL2 Rabbit Polyclonal Antibody
orb1879590-03 100 µL

MAGEL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGEL2 Rabbit Polyclonal Antibody
orb1879590-04 200 µL

MAGEL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details