Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndrg2 Peptide - middle region

Ndrg2 Peptide - middle region

Product Specifications

Product Name Alternative

AI182517, AU040374, Ndr2, SYLD

UniProt

Q9QYG0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndrg2 Rabbit Polyclonal Antibody (orb580240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038892

Preservative

Lyophilized powder

AA Sequence

TEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMA6C (NM_001170944) Human Over-expression Lysate
LC433000 20 µg

PNMA6C (NM_001170944) Human Over-expression Lysate

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (PMEL/783), CF594 conjugate, 0.1mg/mL
BNC940783-500 1x 500 µL

Pmel17 / gp100 / SILV (PMEL/783), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COL20A1 Rabbit Polyclonal Antibody
TA369045 100 µL

COL20A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Amplite® Fluorimetric Sphingomyelinase Assay Kit *Red Fluorescence*
13621-AAT 200 Tests

Amplite® Fluorimetric Sphingomyelinase Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
Recombinant PTGS2 Antibody
RC-3054-01 50 μL

Recombinant PTGS2 Antibody

Sign In for Pricing
View Details
Recombinant PTGS2 Antibody
RC-3054-02 100 µL

Recombinant PTGS2 Antibody

Sign In for Pricing
View Details