Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA11 Peptide - N-terminal region

NDUFA11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B14.7, CI-B14.7

UniProt

Q86Y39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA11 Rabbit Polyclonal Antibody (orb325851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783313

Preservative

Lyophilized powder

AA Sequence

GTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levamfetamine Hydrochloride
TRC-A634240-5MG 5 mg

Levamfetamine Hydrochloride

Sign In for Pricing
View Details
Crygd Mouse Gene Knockout Kit (CRISPR)
KN503871 1 Kit

Crygd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mexrenone
TRC-M340840-1MG 1 mg

Mexrenone

Sign In for Pricing
View Details
4H-Thieno[3,2-c]chromene-2-carboxylic acid
TRC-H956113-50MG 50 mg

4H-Thieno[3,2-c]chromene-2-carboxylic acid

Sign In for Pricing
View Details
FITC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]
E-AB-F1186C-01 50 Tests

FITC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]
E-AB-F1186C-02 100 Tests

FITC Anti-Mouse CD64/FcγRI Antibody[X54-5/7.1]

Sign In for Pricing
View Details