Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA11 Peptide - N-terminal region

NDUFA11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B14.7, CI-B14.7

UniProt

Q86Y39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA11 Rabbit Polyclonal Antibody (orb325851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783313

Preservative

Lyophilized powder

AA Sequence

GTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF15 Human Gene Knockout Kit (CRISPR)
KN401295 1 Kit

GDF15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Canine PDGF R beta / CD140b Protein, His Tag
PDB-C52H3-1mg 1 mg

Canine PDGF R beta / CD140b Protein, His Tag

Sign In for Pricing
View Details
(S)-5-(4-Hydroxyphenyl)-5-ethylhydantoin
TRC-H949226-50MG 50 mg

(S)-5-(4-Hydroxyphenyl)-5-ethylhydantoin

Sign In for Pricing
View Details
SLC5A3 Rabbit Polyclonal Antibody
AP23633PU-N 50 µL

SLC5A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TuberoinfundibuLar peptide (PTH2) (NM_178449) Human Over-expression Lysate
LC403603 20 µg

TuberoinfundibuLar peptide (PTH2) (NM_178449) Human Over-expression Lysate

Sign In for Pricing
View Details
1,4-Butanediol Diglycidyl Ether
TRC-B701365-5G 5 g

1,4-Butanediol Diglycidyl Ether

Sign In for Pricing
View Details