Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB10 Peptide - C-terminal region

NDUFB10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDSW

UniProt

O96000

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB10 Rabbit Polyclonal Antibody (orb585456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004539

Preservative

Lyophilized powder

AA Sequence

NCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idh1 (NM_010497) Mouse Untagged Clone
MC208737 10 µg

Idh1 (NM_010497) Mouse Untagged Clone

Sign In for Pricing
View Details
Fnip1 Mouse qPCR Primer Pair (NM_173753)
MP204909 200 Reactions

Fnip1 Mouse qPCR Primer Pair (NM_173753)

Sign In for Pricing
View Details
Recombinant Human CALML3 Protein (His Tag)
PKSH030828 100 µg

Recombinant Human CALML3 Protein (His Tag)

Sign In for Pricing
View Details
GTF3C3 Rabbit Polyclonal Antibody
TA361779 100 µL

GTF3C3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ppm1b (BC018556) Mouse Untagged Clone
MC218224 10 µg

Ppm1b (BC018556) Mouse Untagged Clone

Sign In for Pricing
View Details
Mcc Mouse siRNA Oligo Duplex (Locus ID 328949)
SR400295 1 Kit

Mcc Mouse siRNA Oligo Duplex (Locus ID 328949)

Sign In for Pricing
View Details