Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB7 Peptide - N-terminal region

NDUFB7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B18, CI-B18, MGC2480

UniProt

P17568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB7 Rabbit Polyclonal Antibody (orb585299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004137

Preservative

Lyophilized powder

AA Sequence

PTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2154608 1.0 µg DNA

SLAMF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Ppbp shRNA (UAS) - Lentiviral mouse Ppbp shRNA (UAS) (100)
GTR15181266 1 Vial

Lentiviral mouse Ppbp shRNA (UAS) - Lentiviral mouse Ppbp shRNA (UAS) (100)

Sign In for Pricing
View Details
MOB3C Protein Vector (Mouse) (pPB-N-His)
PV201419 500 ng

MOB3C Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SMAD5 (Phospho-S463/465) Conjugated Antibody
MBS9456116-01 0.1 mL (Biotin)

SMAD5 (Phospho-S463/465) Conjugated Antibody

Sign In for Pricing
View Details
SMAD5 (Phospho-S463/465) Conjugated Antibody
MBS9456116-02 0.1 mL (AF350)

SMAD5 (Phospho-S463/465) Conjugated Antibody

Sign In for Pricing
View Details
SMAD5 (Phospho-S463/465) Conjugated Antibody
MBS9456116-03 0.1 mL (AF405)

SMAD5 (Phospho-S463/465) Conjugated Antibody

Sign In for Pricing
View Details