Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB7 Peptide - N-terminal region

NDUFB7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B18, CI-B18, MGC2480

UniProt

P17568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB7 Rabbit Polyclonal Antibody (orb585299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004137

Preservative

Lyophilized powder

AA Sequence

PTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UCH-L3 Antibody [Janelia Fluor 549]
NBP2-98339JF549 0.1 mL

Rabbit Polyclonal UCH-L3 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
RutB Antibody
orb828694 2 mg

RutB Antibody

Sign In for Pricing
View Details
Car11-set siRNA/shRNA/RNAi Lentivector (Rat)
15017096 4x 500 ng

Car11-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
PDIA3 Knockout SK-HEP-1 Polyclonal Cells
ARG15377 1 Million

PDIA3 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF568 conjugate, 0.1mg/mL
BNC682065-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDHX (NM_001166158) Human Tagged ORF Clone Lentiviral Particle
RC228205L4V 200 µL

PDHX (NM_001166158) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details