Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufb8 Peptide - C-terminal region

Ndufb8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900010I05Rik, AI987932

UniProt

Q9D6J5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufb8 Rabbit Polyclonal Antibody (orb579812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080337

Preservative

Lyophilized powder

AA Sequence

KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADX Recombinant Rabbit Monoclonal Antibody [JE63-56]
HA721329 100 µL

ADX Recombinant Rabbit Monoclonal Antibody [JE63-56]

Sign In for Pricing
View Details
1,3,5-Tri-O-benzoyl-2-deoxyribofuranose
TRC-T767660-250MG 250 mg

1,3,5-Tri-O-benzoyl-2-deoxyribofuranose

Sign In for Pricing
View Details
Pallidin (BLOC1S6) Human Gene Knockout Kit (CRISPR)
KN401514 1 Kit

Pallidin (BLOC1S6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF594 conjugate, 0.1mg/mL
BNC942173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), Biotin conjugate, 0.1mg/mL
BNCB0639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp770 Mouse Gene Knockout Kit (CRISPR)
KN519972 1 Kit

Zfp770 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details