Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufb8 Peptide - C-terminal region

Ndufb8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900010I05Rik, AI987932

UniProt

Q9D6J5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufb8 Rabbit Polyclonal Antibody (orb579812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080337

Preservative

Lyophilized powder

AA Sequence

KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GANAB, C-His Tag
HA210610-01 20 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details
Human GANAB, C-His Tag
HA210610-02 50 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details
Human GANAB, C-His Tag
HA210610-03 100 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymph node
CB536230 1 Block

Frozen Tissue Blocks, Lymph node

Sign In for Pricing
View Details
Carburetor Ultrasonic BULC-604
BULC-604 1 Unit

Carburetor Ultrasonic BULC-604

Sign In for Pricing
View Details
EZH2 Rabbit Polyclonal Antibody
TA376052 100 µL

EZH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details