Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS8 Peptide - C-terminal region

NDUFS8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CI23KD, TYKY, CI-23k

UniProt

O00217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFS8 Rabbit Polyclonal Antibody (orb331152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002487

Preservative

Lyophilized powder

AA Sequence

CKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody [Clone ID: OTI3A1]
CF809117 100 µg

Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody [Clone ID: OTI3A1]

Sign In for Pricing
View Details
Argonaute 2 (AGO2) Human Knockdown Lysate
LY300029 100 µg

Argonaute 2 (AGO2) Human Knockdown Lysate

Sign In for Pricing
View Details
IL-10RB Mouse Monoclonal Antibody [A8E11]
HA601061 100 µL

IL-10RB Mouse Monoclonal Antibody [A8E11]

Sign In for Pricing
View Details
Coumarin
TRC-C755380-50MG 50 mg

Coumarin

Sign In for Pricing
View Details
Transthyretin (Prealbumin) (CPTC-TTR-1), 1mg/mL
BNUM2249-50 1x 50 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), 1mg/mL

Sign In for Pricing
View Details
Cell Meter™ BX590 fixable viability dye
22514-AAT 200 Tests

Cell Meter™ BX590 fixable viability dye

Sign In for Pricing
View Details