Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS8 Peptide - C-terminal region

NDUFS8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CI23KD, TYKY, CI-23k

UniProt

O00217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFS8 Rabbit Polyclonal Antibody (orb331152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002487

Preservative

Lyophilized powder

AA Sequence

CKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Conjugated Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-
I-6301-1 1 mg

Ferritin Conjugated Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF740 conjugate, 0.1mg/mL
BNC743347-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAAF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G6]
TA507217AM 100 µL

PAAF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G6]

Sign In for Pricing
View Details
CD6 Antibody (HRP)
KH-1802-01 50 μL

CD6 Antibody (HRP)

Sign In for Pricing
View Details
CD6 Antibody (HRP)
KH-1802-02 100 µL

CD6 Antibody (HRP)

Sign In for Pricing
View Details
CD6 Antibody (HRP)
KH-1802-03 1 mL

CD6 Antibody (HRP)

Sign In for Pricing
View Details