Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufv2 Peptide - C-terminal region

Ndufv2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900010C23Rik

UniProt

Q9D6J6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufv2 Rabbit Polyclonal Antibody (orb583592) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082664

Preservative

Lyophilized powder

AA Sequence

DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp239 (NM_008616) Mouse Tagged ORF Clone
MG202057 10 µg

Zfp239 (NM_008616) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NMUR2 (NM_020167) Human Over-expression Lysate
LY402759 100 µg

NMUR2 (NM_020167) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant KRIT1 Antibody
RC-5103-01 50 μL

Recombinant KRIT1 Antibody

Sign In for Pricing
View Details
Recombinant KRIT1 Antibody
RC-5103-02 100 µL

Recombinant KRIT1 Antibody

Sign In for Pricing
View Details
Recombinant KRIT1 Antibody
RC-5103-03 1 mL

Recombinant KRIT1 Antibody

Sign In for Pricing
View Details
Akap13 Mouse Gene Knockout Kit (CRISPR)
KN501065 1 Kit

Akap13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details