Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufv2 Peptide - C-terminal region

Ndufv2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900010C23Rik

UniProt

Q9D6J6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufv2 Rabbit Polyclonal Antibody (orb583592) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082664

Preservative

Lyophilized powder

AA Sequence

DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDE1 Recombinant Rabbit Monoclonal Antibody [JE65-67]
HA721071 100 µL

CSDE1 Recombinant Rabbit Monoclonal Antibody [JE65-67]

Sign In for Pricing
View Details
(2,4,6-Trichlorophenoxy)acetic Acid-13C6
TRC-T774582-1MG 1 mg

(2,4,6-Trichlorophenoxy)acetic Acid-13C6

Sign In for Pricing
View Details
Isoquinoline
TRC-I874930-250G 250 g

Isoquinoline

Sign In for Pricing
View Details
Human Endostatin/COL18A1, Tag Free
HA211001-01 Inquire

Human Endostatin/COL18A1, Tag Free

Sign In for Pricing
View Details
Human Endostatin/COL18A1, Tag Free
HA211001-02 50 µg

Human Endostatin/COL18A1, Tag Free

Sign In for Pricing
View Details
Human Endostatin/COL18A1, Tag Free
HA211001-03 100 µg

Human Endostatin/COL18A1, Tag Free

Sign In for Pricing
View Details