Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB2 Peptide - C-terminal region

NECAB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EFCBP2

UniProt

Q7Z6G3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB2 Rabbit Polyclonal Antibody (orb585426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061938

Preservative

Lyophilized powder

AA Sequence

SHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin, type I cytoskeletal 17
AP84456-01 50 µg

Keratin, type I cytoskeletal 17

Sign In for Pricing
View Details
Keratin, type I cytoskeletal 17
AP84456-02 100 µg

Keratin, type I cytoskeletal 17

Sign In for Pricing
View Details
Keratin, type I cytoskeletal 17
AP84456-03 1 mg

Keratin, type I cytoskeletal 17

Sign In for Pricing
View Details
LOC294154 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV643306 1.0 µg DNA

LOC294154 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human Ectonucleotide Pyrophosphatase-Phosphodiesterase 1 (ENPP1) ELISA Kit
YP-W16969-01 48 Tests

Human Ectonucleotide Pyrophosphatase-Phosphodiesterase 1 (ENPP1) ELISA Kit

Sign In for Pricing
View Details
Human Ectonucleotide Pyrophosphatase-Phosphodiesterase 1 (ENPP1) ELISA Kit
YP-W16969-02 96 Tests

Human Ectonucleotide Pyrophosphatase-Phosphodiesterase 1 (ENPP1) ELISA Kit

Sign In for Pricing
View Details