Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB2 Peptide - C-terminal region

NECAB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EFCBP2

UniProt

Q7Z6G3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB2 Rabbit Polyclonal Antibody (orb585426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061938

Preservative

Lyophilized powder

AA Sequence

SHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP6 (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 6, Ectonucleotide Pyrophosphatase/Phosphodiesterase 6)
480216 100 µL

ENPP6 (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 6, Ectonucleotide Pyrophosphatase/Phosphodiesterase 6)

Sign In for Pricing
View Details
FYCO1 Human qPCR Primer Pair (NM_024513)
HP214824 200 Reactions

FYCO1 Human qPCR Primer Pair (NM_024513)

Sign In for Pricing
View Details
TYK2 Polyclonal Antibody
E-AB-93276-01 60 µL

TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
TYK2 Polyclonal Antibody
E-AB-93276-02 120 µL

TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
TYK2 Polyclonal Antibody
E-AB-93276-03 200 µL

TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
Micafungin Impurity 16
RM-M030626-01 10 mg

Micafungin Impurity 16

Sign In for Pricing
View Details