Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB3 Peptide - N-terminal region

NECAB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5

UniProt

Q96P71

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB3 Rabbit Polyclonal Antibody (orb583659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112509

Preservative

Lyophilized powder

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Dysenteriae lplT Protein (aa 1-397)
VAng-Lsx06966-inquire Inquire

Recombinant Shigella Dysenteriae lplT Protein (aa 1-397)

Sign In for Pricing
View Details
SMG7 (NM_001174061) Human Tagged ORF Clone
RC230659 10 µg

SMG7 (NM_001174061) Human Tagged ORF Clone

Sign In for Pricing
View Details
GEMIN5 Adenovirus (Rat)
21439056 1.0 mL

GEMIN5 Adenovirus (Rat)

Sign In for Pricing
View Details
Guinea Pig anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit
GTR10460636 96 Well

Guinea Pig anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Anti-IL-33 Rabbit pAb
GB115484 100 μL

Anti-IL-33 Rabbit pAb

Sign In for Pricing
View Details
THOP1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-11683R-PE-Cy5.5 100 µL

THOP1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details