Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB3 Peptide - N-terminal region

NECAB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5

UniProt

Q96P71

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB3 Rabbit Polyclonal Antibody (orb583659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112509

Preservative

Lyophilized powder

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK7 Antibody
CSB-PA158224-01 50 μL

PAK7 Antibody

Sign In for Pricing
View Details
PAK7 Antibody
CSB-PA158224-02 100 µL

PAK7 Antibody

Sign In for Pricing
View Details
Anti-MASP2 Antibody Picoband®, HRP Conjugate
A02323-1-HRP 100 µg/Vial

Anti-MASP2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Fish Alkaline phosphatase (ALP) ELISA Kit
EK12279 48 Tests

Fish Alkaline phosphatase (ALP) ELISA Kit

Sign In for Pricing
View Details
KIF3C Antibody, HRP conjugated
MBS7109876-01 0.05 mg

KIF3C Antibody, HRP conjugated

Sign In for Pricing
View Details
KIF3C Antibody, HRP conjugated
MBS7109876-02 0.1 mg

KIF3C Antibody, HRP conjugated

Sign In for Pricing
View Details