NECAB3 Peptide - middle region
NECAB3 Peptide - middle region
Product Specifications
Product Name Alternative
APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5
UniProt
Q96P71
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NECAB3 Rabbit Polyclonal Antibody (orb583660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112509
Preservative
Lyophilized powder
AA Sequence
ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1125617 Inquire
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B ATP synthase subunit b (atpF)
Sign In for Pricing
View Details 43514154 3x 1.0 µg DNA
SESN1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 
