Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB3 Peptide - middle region

NECAB3 Peptide - middle region

Product Specifications

Product Name Alternative

APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5

UniProt

Q96P71

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB3 Rabbit Polyclonal Antibody (orb583660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112509

Preservative

Lyophilized powder

AA Sequence

ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyroglutamylhistidine
MBS5783725 Inquire

Pyroglutamylhistidine

Sign In for Pricing
View Details
Human GABA-AR alpha 2 ELISA Kit (Colorimetric)
NBP3-31741 1 Kit

Human GABA-AR alpha 2 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
trans-Benperidol N-Oxide
TRC-O170110-1MG 1 mg

trans-Benperidol N-Oxide

Sign In for Pricing
View Details
Rat FOS shRNA Plasmid
abx989815-01 150 µg

Rat FOS shRNA Plasmid

Sign In for Pricing
View Details
Rat FOS shRNA Plasmid
abx989815-02 300 µg

Rat FOS shRNA Plasmid

Sign In for Pricing
View Details
ACADS (NM_000017) Human Recombinant Protein
TP306855L 1 mg

ACADS (NM_000017) Human Recombinant Protein

Sign In for Pricing
View Details