Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necap1 Peptide - N-terminal region

Necap1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1200016B17Rik, AI747569, FLJ00061, mFLJ00061

UniProt

Q9CR95

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Necap1 Rabbit Polyclonal Antibody (orb582689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080543

Preservative

Lyophilized powder

AA Sequence

RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone: femur, head
CS702409 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
3-Iodothyronamine Hydrochloride
TRC-I720500-2.5MG 2.5 mg

3-Iodothyronamine Hydrochloride

Sign In for Pricing
View Details
DNALI1 (C-term) Rabbit Polyclonal Antibody
AP51299PU-N 400 µL

DNALI1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diethyl Sulfide
TRC-D445005-1G 1 g

Diethyl Sulfide

Sign In for Pricing
View Details
Adcy1 Mouse Gene Knockout Kit (CRISPR)
KN500886 1 Kit

Adcy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DTX2 (NM_001102595) Human Over-expression Lysate
LY420164 100 µg

DTX2 (NM_001102595) Human Over-expression Lysate

Sign In for Pricing
View Details