Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necap1 Peptide - N-terminal region

Necap1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1200016B17Rik, AI747569, FLJ00061, mFLJ00061

UniProt

Q9CR95

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Necap1 Rabbit Polyclonal Antibody (orb582689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080543

Preservative

Lyophilized powder

AA Sequence

RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VC pUC19 / Msp I Marker (ready-to-use), 5 x 50µg
NM2416 5 x 50μg

VC pUC19 / Msp I Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
Colloidal Gold Conjugated Cytisus sscoparius Lectin (Scotch broom) -CSA-,  30nm
GP-3201-30 1 mL

Colloidal Gold Conjugated Cytisus sscoparius Lectin (Scotch broom) -CSA-, 30nm

Sign In for Pricing
View Details
Cftr Mouse Gene Knockout Kit (CRISPR)
KN503220 1 Kit

Cftr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Intervertebral disc
CS706619 5x 5 µm

Tissue FFPE Sections, Intervertebral disc

Sign In for Pricing
View Details
Human Septin 11 (SEPT11) activation kit by CRISPRa
GA110938 1 Kit

Human Septin 11 (SEPT11) activation kit by CRISPRa

Sign In for Pricing
View Details
PDGF Receptor beta (PDGFRB) (NM_002609) Human Over-expression Lysate
LY400921 100 µg

PDGF Receptor beta (PDGFRB) (NM_002609) Human Over-expression Lysate

Sign In for Pricing
View Details