Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEGR1 Peptide - N-terminal region

NEGR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DMML2433, IGLON4, KILON, MGC46680, Ntra

UniProt

Q7Z3B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEGR1 Rabbit Polyclonal Antibody (orb330814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776169

Preservative

Lyophilized powder

AA Sequence

WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Thiophen-2-yl) -2,3-dihydro-1H-naphtho[1,8-de][1,3,2]diazaborinine
OR303524 1 Each

2- (Thiophen-2-yl) -2,3-dihydro-1H-naphtho[1,8-de][1,3,2]diazaborinine

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1+S2 (T19R, V70F, E156G, 157-158 deletion, A222V, K417N, L452R, T478K, D614G, P681R, D950N) Protein (ECD, His Tag)
PO55002I2 100 µg

SARS-CoV-2 Spike S1+S2 (T19R, V70F, E156G, 157-158 deletion, A222V, K417N, L452R, T478K, D614G, P681R, D950N) Protein (ECD, His Tag)

Sign In for Pricing
View Details
TAS2R49 (TAS2R20) Rabbit Polyclonal Antibody
AP01339PU-N 100 µg

TAS2R49 (TAS2R20) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLJ37396 Rabbit Polyclonal Antibody (BF594)
orb2502862 100 µL

FLJ37396 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Mouse Clcc1 Pre-designed siRNA Set B
SI102661B 1 Each

Mouse Clcc1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MPZL1 antibody
70R-18585 50 ul

MPZL1 antibody

Sign In for Pricing
View Details