Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEGR1 Peptide - N-terminal region

NEGR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DMML2433, IGLON4, KILON, MGC46680, Ntra

UniProt

Q7Z3B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEGR1 Rabbit Polyclonal Antibody (orb330814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776169

Preservative

Lyophilized powder

AA Sequence

WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S375 Adenovirus (Human)
39957051 1.0 mL

RN5S375 Adenovirus (Human)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Furin (FUR)
MBS2001898-01 0.1 mL

Biotin-Linked Antibody to Furin (FUR)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Furin (FUR)
MBS2001898-02 0.2 mL

Biotin-Linked Antibody to Furin (FUR)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Furin (FUR)
MBS2001898-03 0.5 mL

Biotin-Linked Antibody to Furin (FUR)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Furin (FUR)
MBS2001898-04 1 mL

Biotin-Linked Antibody to Furin (FUR)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Furin (FUR)
MBS2001898-05 5 mL

Biotin-Linked Antibody to Furin (FUR)

Sign In for Pricing
View Details