Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nek7 Peptide - C-terminal region

Nek7 Peptide - C-terminal region

Product Specifications

UniProt

D3ZBE5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nek7 Rabbit Polyclonal Antibody (orb580613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101816

Preservative

Lyophilized powder

AA Sequence

EQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (B22.1), CF488A conjugate, 0.1mg/mL
BNC881219-500 1x 500 µL

Cytokeratin 8 (B22.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin Recombinant Mouse monoclonal Antibody
HA610047 100 µg

E-Cadherin Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) (NM_181652) Human Recombinant Protein
TP317362M 100 µg

Peroxiredoxin 5 (PRDX5) (NM_181652) Human Recombinant Protein

Sign In for Pricing
View Details
OR12D3 Human Gene Knockout Kit (CRISPR)
KN418062 1 Kit

OR12D3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-O-Octadecyl-2-O-benzyl-rac-glycerol
TRC-O235950-1G 1 g

1-O-Octadecyl-2-O-benzyl-rac-glycerol

Sign In for Pricing
View Details
ST6GAL2 Human Gene Knockout Kit (CRISPR)
KN419685 1 Kit

ST6GAL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details