Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nek7 Peptide - C-terminal region

Nek7 Peptide - C-terminal region

Product Specifications

UniProt

D3ZBE5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nek7 Rabbit Polyclonal Antibody (orb580613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101816

Preservative

Lyophilized powder

AA Sequence

EQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Biotinylamino-3,6,9-trioxaundecane-11-ol
TRC-B395060-25MG 25 mg

1-Biotinylamino-3,6,9-trioxaundecane-11-ol

Sign In for Pricing
View Details
Human WDR75 activation kit by CRISPRa
GA113381 1 Kit

Human WDR75 activation kit by CRISPRa

Sign In for Pricing
View Details
L-Lysine-13C6,15N2 Hydrochloride
TRC-L488533-50MG 50 mg

L-Lysine-13C6,15N2 Hydrochloride

Sign In for Pricing
View Details
Recombinant DENV-2 (Strain New Guinea C) Capsid protein / DENV-C Protein (His Tag)
PKSV030132 100 µg

Recombinant DENV-2 (Strain New Guinea C) Capsid protein / DENV-C Protein (His Tag)

Sign In for Pricing
View Details
2,3,4-Trichloroaniline
TRC-T774025-25G 25 g

2,3,4-Trichloroaniline

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF405S conjugate, 0.1mg/mL
BNC042955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details