Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurog2 Peptide - C-terminal region

Neurog2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Atoh4, Math4A, bHLHa8, ngn-2, ngn2

UniProt

P70447

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Neurog2 Rabbit Polyclonal Antibody (orb577187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033848

Preservative

Lyophilized powder

AA Sequence

NSPASSSNSTSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJB1 (NM_001097642) Human Over-expression Lysate
LC420416 20 µg

GJB1 (NM_001097642) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/iFluor® 750 Anti-human CD4 Antibody *SK3*
100421R0-AAT 25 Tests

PE/iFluor® 750 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF405S conjugate, 0.1mg/mL
BNC041981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Arginase-1/ARG1 Protein (His & MYC Tag)
PKSH030301 50 µg

Recombinant Human Arginase-1/ARG1 Protein (His & MYC Tag)

Sign In for Pricing
View Details
Human CD36 activation kit by CRISPRa
GA100670 1 Kit

Human CD36 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Azidosalicylic Acid(>90%)
TRC-A857925-250MG 250 mg

4-Azidosalicylic Acid(>90%)

Sign In for Pricing
View Details