Neurog3 Peptide - middle region
Neurog3 Peptide - middle region
Product Specifications
Product Name Alternative
Atoh5, MGC129292, MGC129293, Math4B, ngn3, bHLHa7
UniProt
Q9D8I0
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Neurog3 Rabbit Polyclonal Antibody (orb574191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033849
Preservative
Lyophilized powder
AA Sequence
NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine7 Anti-Mouse CD4 Antibody[GK1.5]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d414b/imageurl/e-ab-f1097h.webp)
E-AB-F1097H-02 100 Tests
PE/Cyanine7 Anti-Mouse CD4 Antibody[GK1.5]
Sign In for Pricing
View Details E-AB-F1097H-03 2x 100 Tests
PE/Cyanine7 Anti-Mouse CD4 Antibody[GK1.5]
Sign In for Pricing
View Details 
PKSH033882-01 10 µg
Recombinant Human Signal-Regulatory Protein alpha-1/SIRPA/CD172a (C-6His)
Sign In for Pricing
View Details PKSH033882-02 50 µg
Recombinant Human Signal-Regulatory Protein alpha-1/SIRPA/CD172a (C-6His)
Sign In for Pricing
View Details