Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurog3 Peptide - middle region

Neurog3 Peptide - middle region

Product Specifications

Product Name Alternative

Atoh5, MGC129292, MGC129293, Math4B, ngn3, bHLHa7

UniProt

Q9D8I0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Neurog3 Rabbit Polyclonal Antibody (orb574191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033849

Preservative

Lyophilized powder

AA Sequence

NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4, Mouse (T-Cell Marker) (GK1.5), CF700 conjugate, 0.1mg/mL
BNC002009-100 1x 100 µL

CD4, Mouse (T-Cell Marker) (GK1.5), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL
BNC683101-500 1x 500 µL

PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP1 (Marker of Lymph Node Metastasis) (2A5), Biotin conjugate, 0.1mg/mL
BNCB1648-500 1x 500 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFNW1 (NM_002177) Human Over-expression Lysate
LY419484 100 µg

IFNW1 (NM_002177) Human Over-expression Lysate

Sign In for Pricing
View Details
OR10K2 Human Gene Knockout Kit (CRISPR)
KN423327 1 Kit

OR10K2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GALNT3 Antibody
KC-3322-01 50 μL

GALNT3 Antibody

Sign In for Pricing
View Details