Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC2 Peptide - C-terminal region

NFATC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NFAT1, NFATP

UniProt

Q13469

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFATC2 Rabbit Polyclonal Antibody (orb576923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_775114

Preservative

Lyophilized powder

AA Sequence

PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal COMMD8 Antibody (006) [mFluor Violet 450 SE]
NBP2-90299MFV450 0.1 mL

Rabbit Monoclonal COMMD8 Antibody (006) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TRAC-1 Polyclonal Antibody
MBS8525696-01 0.1 mg

TRAC-1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAC-1 Polyclonal Antibody
MBS8525696-02 0.1 mL (AF635)

TRAC-1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAC-1 Polyclonal Antibody
MBS8525696-03 0.1 mL (AF610)

TRAC-1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAC-1 Polyclonal Antibody
MBS8525696-04 0.1 mL (AF405S)

TRAC-1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAC-1 Polyclonal Antibody
MBS8525696-05 0.1 mL (AF405L)

TRAC-1 Polyclonal Antibody

Sign In for Pricing
View Details