Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2 Peptide - N-terminal region

NFE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NF-E2, p45

UniProt

Q16621

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFE2 Rabbit Polyclonal Antibody (orb573741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006154

Preservative

Lyophilized powder

AA Sequence

MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6E (NM_002346) Human Over-expression Lysate
LC400842 20 µg

LY6E (NM_002346) Human Over-expression Lysate

Sign In for Pricing
View Details
Gabazine
TRC-G122500-5MG 5 mg

Gabazine

Sign In for Pricing
View Details
Glycocholic Acid Sodium Salt
TRC-G641368-500MG 500 mg

Glycocholic Acid Sodium Salt

Sign In for Pricing
View Details
Cell Meter™ Fluorimetric Mitochondrial Superoxide Activity Assay Kit*Optimized for Microplate Reader*
22971-AAT 200 Tests

Cell Meter™ Fluorimetric Mitochondrial Superoxide Activity Assay Kit*Optimized for Microplate Reader*

Sign In for Pricing
View Details
EB 47-d8
TRC-E320302-25MG 25 mg

EB 47-d8

Sign In for Pricing
View Details
DNMT3A (NM_022552) Human Recombinant Protein
TP313064 20 µg

DNMT3A (NM_022552) Human Recombinant Protein

Sign In for Pricing
View Details