Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2L1 Peptide - C-terminal region

NFE2L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ00380, LCR-F1, NRF1, TCF11

UniProt

Q14494

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFE2L1 Rabbit Polyclonal Antibody (orb573727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003195

Preservative

Lyophilized powder

AA Sequence

HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANG Polyclonal Antibody
ABP60087-01 30 µL

RANG Polyclonal Antibody

Sign In for Pricing
View Details
RANG Polyclonal Antibody
ABP60087-02 100 µL

RANG Polyclonal Antibody

Sign In for Pricing
View Details
RANG Polyclonal Antibody
ABP60087-03 200 µL

RANG Polyclonal Antibody

Sign In for Pricing
View Details
Int-6 CRISPR/Cas9 KO Plasmid (h)
sc-405759 20 µg

Int-6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
MAP2K2 protein (His tag)
80R-2260 10 ug

MAP2K2 protein (His tag)

Sign In for Pricing
View Details
Human C19orf29-AS1 ELISA KIT
ELI-50553h 96 Tests

Human C19orf29-AS1 ELISA KIT

Sign In for Pricing
View Details