Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2L1 Peptide - C-terminal region

NFE2L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ00380, LCR-F1, NRF1, TCF11

UniProt

Q14494

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFE2L1 Rabbit Polyclonal Antibody (orb573727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003195

Preservative

Lyophilized powder

AA Sequence

HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-5 (500-M40)
sc-65351 100 µg/mL

FGF-5 (500-M40)

Sign In for Pricing
View Details
FUT8, ID (FUT8, Alpha- (1,6) -fucosyltransferase, Fucosyltransferase 8, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, GDP-fucose-glycoprotein fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase) (APC) discontinued
035805-APC 200 µL

FUT8, ID (FUT8, Alpha- (1,6) -fucosyltransferase, Fucosyltransferase 8, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, GDP-fucose-glycoprotein fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase) (APC) discontinued

Sign In for Pricing
View Details
Sec11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3862007 1.0 µg DNA

Sec11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Sucrose Assay Kit
BC171 50 Tests - 48 Samples

Sucrose Assay Kit

Sign In for Pricing
View Details
TP53I13 (NM_138349) Human Over-expression Lysate
LS090313-100ug 100 µg

TP53I13 (NM_138349) Human Over-expression Lysate

Sign In for Pricing
View Details
Plasma Membrane GFP Tag Human Umbilical Vein Endothelial Cells
cAP-0001GFP-PM 1 Frozen Vial

Plasma Membrane GFP Tag Human Umbilical Vein Endothelial Cells

Sign In for Pricing
View Details