Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2L1 Peptide - C-terminal region

NFE2L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ00380, LCR-F1, NRF1, TCF11

UniProt

Q14494

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFE2L1 Rabbit Polyclonal Antibody (orb573727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003195

Preservative

Lyophilized powder

AA Sequence

HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASH1 Antibody
A53158-50UL 50 μL

VASH1 Antibody

Sign In for Pricing
View Details
IL-17B Rabbit Polyclonal Antibody (PerCP)
orb2436003 100 µL

IL-17B Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
STAT2, Antibody
GWB-6CDE00 1 mL

STAT2, Antibody

Sign In for Pricing
View Details
F13A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
19610151 3x 1.0 µg DNA

F13A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Calsenilin/KCNIP3 (Ab-63) Antibody
8B1024-AAT 50 µg

Calsenilin/KCNIP3 (Ab-63) Antibody

Sign In for Pricing
View Details
Recombinant Human AMY2B protein, C-His Tag
MBS1560683-01 0.05 mg

Recombinant Human AMY2B protein, C-His Tag

Sign In for Pricing
View Details