Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKBID Peptide - C-terminal region

NFKBID Peptide - C-terminal region

Product Specifications

Product Name Alternative

IkappaBNS, MGC11314, MGC149503, TA-NFKBH

UniProt

Q8NI38

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFKBID Rabbit Polyclonal Antibody (orb584747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640332

Preservative

Lyophilized powder

AA Sequence

QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RB1, Phosphorylated (Ser788) (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) (MaxLight 405)
MBS6497382-01 0.1 mL

RB1, Phosphorylated (Ser788) (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) (MaxLight 405)

Sign In for Pricing
View Details
RB1, Phosphorylated (Ser788) (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) (MaxLight 405)
MBS6497382-02 5x 0.1 mL

RB1, Phosphorylated (Ser788) (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) (MaxLight 405)

Sign In for Pricing
View Details
PIC 648-DIA 100-B7525 AC Signs
223197 Card of 1 Pictogram(s)

PIC 648-DIA 100-B7525 AC Signs

Sign In for Pricing
View Details
HCRTR1 Antibody
orb1259812 100 µL

HCRTR1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal POLN Antibody (1G2/2) [DyLight 755]
NBP2-50253IR 0.1 mL

Mouse Monoclonal POLN Antibody (1G2/2) [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human CXCL2/GRO-beta/MIP2-alpha Protein, N-His
YHD36001 100 μg

Recombinant Human CXCL2/GRO-beta/MIP2-alpha Protein, N-His

Sign In for Pricing
View Details