Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFYB Peptide - middle region

NFYB Peptide - middle region

Product Specifications

Product Name Alternative

CBF-A, CBF-B, HAP3, NF-YB

UniProt

P25208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFYB Rabbit Polyclonal Antibody (orb573751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006157

Preservative

Lyophilized powder

AA Sequence

EAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFESD (Center) Rabbit Polyclonal Antibody
AP53637PU-N 400 µL

RFESD (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vildagliptin Cyclo Imidamide
TRC-V305010-50MG 50 mg

Vildagliptin Cyclo Imidamide

Sign In for Pricing
View Details
CCR2 (NM_000647) Human Over-expression Lysate
LC424596 20 µg

CCR2 (NM_000647) Human Over-expression Lysate

Sign In for Pricing
View Details
ARL6 (NM_032146) Human Recombinant Protein
TP305966 20 µg

ARL6 (NM_032146) Human Recombinant Protein

Sign In for Pricing
View Details
Serpinb9e Mouse Gene Knockout Kit (CRISPR)
KN515599 1 Kit

Serpinb9e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Recombinant Protein
TP316541M 100 µg

GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Recombinant Protein

Sign In for Pricing
View Details