Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNU13 Peptide - N-terminal region

SNU13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FA1, FA-1, NHPX, 15.5K, OTK27, SSFA1, NHP2L1, SPAG12, SNRNP15-5

UniProt

P55769

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNU13 Rabbit Polyclonal Antibody (orb577501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003796

Preservative

Lyophilized powder

AA Sequence

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trans-3-Fluorocyclobutanamine
PC105478 1 Each

Trans-3-Fluorocyclobutanamine

Sign In for Pricing
View Details
BrdU Rat Monoclonal Antibody [Clone ID: OTI4A3G8]
TA190195 100 µL

BrdU Rat Monoclonal Antibody [Clone ID: OTI4A3G8]

Sign In for Pricing
View Details
SERPINB11 Protein Vector (Mouse) (pPM-C-His)
PV228093 500 ng

SERPINB11 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Evl shRNA (UAS) - Lentiviral mouse Evl shRNA (UAS, iRFP) plasmid
GTR15243880 1 Vial

Lentiviral mouse Evl shRNA (UAS) - Lentiviral mouse Evl shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
STAU1 siRNA (h)
sc-76586 10 µM

STAU1 siRNA (h)

Sign In for Pricing
View Details
Mouse Monoclonal VEGF Antibody (VEGF/1063) [Biotin]
NBP3-11437B 0.1 mL

Mouse Monoclonal VEGF Antibody (VEGF/1063) [Biotin]

Sign In for Pricing
View Details