Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKD1 Peptide - middle region

NKD1 Peptide - middle region

Product Specifications

Product Name Alternative

Naked1

UniProt

Q969G9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NKD1 Rabbit Polyclonal Antibody (orb577993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149110

Preservative

Lyophilized powder

AA Sequence

LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-024767
T127873-01 10 mg

Compound NP-024767

Sign In for Pricing
View Details
Compound NP-024767
T127873-02 1 g

Compound NP-024767

Sign In for Pricing
View Details
Compound NP-024767
T127873-03 1 mg

Compound NP-024767

Sign In for Pricing
View Details
Compound NP-024767
T127873-04 50 mg

Compound NP-024767

Sign In for Pricing
View Details
Compound NP-024767
T127873-05 5 mg

Compound NP-024767

Sign In for Pricing
View Details
4-Oxo-4-[4- (3-phenylprop-2-enyl) piperazinyl]but-2-enoic acid
OR10263 1 Each

4-Oxo-4-[4- (3-phenylprop-2-enyl) piperazinyl]but-2-enoic acid

Sign In for Pricing
View Details