Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKD1 Peptide - middle region

NKD1 Peptide - middle region

Product Specifications

Product Name Alternative

Naked1

UniProt

Q969G9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NKD1 Rabbit Polyclonal Antibody (orb577993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149110

Preservative

Lyophilized powder

AA Sequence

LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDH6 Antibody
orb796024 2 mg

SDH6 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal BID Antibody (002) [Alexa Fluor 647]
NBP2-89515AF647 0.1 mL

Rabbit Monoclonal BID Antibody (002) [Alexa Fluor 647]

Sign In for Pricing
View Details
RBM22 Antibody, Biotin conjugated
CSB-PA889126LD01HU-01 50 µg

RBM22 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RBM22 Antibody, Biotin conjugated
CSB-PA889126LD01HU-02 100 µg

RBM22 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ABCD3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV707017 1.0 µg DNA

ABCD3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HOXA7 Antibody - N-terminal region : FITC (ARP32637_P050-FITC)
ARP32637_P050-FITC 100 µL

HOXA7 Antibody - N-terminal region : FITC (ARP32637_P050-FITC)

Sign In for Pricing
View Details