Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRP2 Peptide - C-terminal region

NLRP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2

UniProt

Q9NX02

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLRP2 Rabbit Polyclonal Antibody (orb583426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060322

Preservative

Lyophilized powder

AA Sequence

FSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acaryochloris marina Elongation factor 4 (lepA), partial
MBS1087566 Inquire

Recombinant Acaryochloris marina Elongation factor 4 (lepA), partial

Sign In for Pricing
View Details
PPLK/GFP+Puro-Lkb1 shRNA-2
PPL70023-3b 1 Each

PPLK/GFP+Puro-Lkb1 shRNA-2

Sign In for Pricing
View Details
Human Dickkopf-Related Protein 3 ELISA Kit
MBS8410544-01 1 Kit

Human Dickkopf-Related Protein 3 ELISA Kit

Sign In for Pricing
View Details
Human Dickkopf-Related Protein 3 ELISA Kit
MBS8410544-02 5x 1 Kit

Human Dickkopf-Related Protein 3 ELISA Kit

Sign In for Pricing
View Details
DHX36 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2515884 100 µL

DHX36 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
CD69 Polyclonal Antibody
ABP50915-01 30 µL

CD69 Polyclonal Antibody

Sign In for Pricing
View Details