Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMNAT3 Peptide - N-terminal region

NMNAT3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PNAT3, FKSG76, PNAT-3

UniProt

Q96T66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NMNAT3 Rabbit Polyclonal Antibody (orb330576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835471

Preservative

Lyophilized powder

AA Sequence

QVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL2A Antibody
KC-8190-01 50 μL

METTL2A Antibody

Sign In for Pricing
View Details
METTL2A Antibody
KC-8190-02 100 µL

METTL2A Antibody

Sign In for Pricing
View Details
METTL2A Antibody
KC-8190-03 1 mL

METTL2A Antibody

Sign In for Pricing
View Details
3-Amino-3-azabicyclo[3,3,0]octane Hydrochloride
TRC-A583705-50G 50 g

3-Amino-3-azabicyclo[3,3,0]octane Hydrochloride

Sign In for Pricing
View Details
Rabphilin 3A (RPH3A) (NM_001143854) Human Over-expression Lysate
LC428390 20 µg

Rabphilin 3A (RPH3A) (NM_001143854) Human Over-expression Lysate

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF740 conjugate, 0.1mg/mL
BNC740410-100 1x 100 µL

MALT-1 (MT1/410), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details