Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMNAT3 Peptide - N-terminal region

NMNAT3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PNAT3, FKSG76, PNAT-3

UniProt

Q96T66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NMNAT3 Rabbit Polyclonal Antibody (orb330576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835471

Preservative

Lyophilized powder

AA Sequence

QVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Carboxylesterase 1D/SES1D Protein (His Tag)
PKSM040714 50 µg

Recombinant Mouse Carboxylesterase 1D/SES1D Protein (His Tag)

Sign In for Pricing
View Details
AATOM™ 620 alkyne
70264-AAT 1 mg

AATOM™ 620 alkyne

Sign In for Pricing
View Details
RASGRP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA801445AM 100 µL

RASGRP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details
5-Pyridin-3-ylfuran-2-carboxylic Acid
TRC-P266736-500MG 500 mg

5-Pyridin-3-ylfuran-2-carboxylic Acid

Sign In for Pricing
View Details
Uncoated Human HAVCR2 (Hepatitis A Virus Cellular Receptor 2) ELISA Kit
E-UNEL-H0299-01 5x 96 Tests

Uncoated Human HAVCR2 (Hepatitis A Virus Cellular Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human HAVCR2 (Hepatitis A Virus Cellular Receptor 2) ELISA Kit
E-UNEL-H0299-02 15x 96 Tests

Uncoated Human HAVCR2 (Hepatitis A Virus Cellular Receptor 2) ELISA Kit

Sign In for Pricing
View Details