Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNAT Peptide - middle region

NNAT Peptide - middle region

Product Specifications

Product Name Alternative

MGC1439, Peg5

UniProt

Q16517

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NNAT Rabbit Polyclonal Antibody (orb325280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859017

Preservative

Lyophilized powder

AA Sequence

MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Fos B (Ser27) Polyclonal Antibody, Cy5 Conjugated
bs-13198R-Cy5 100 µL

Phospho-Fos B (Ser27) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein
E45H38788M5 20 µg

Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

Sign In for Pricing
View Details
OR52A4 Protein Vector (Human) (pPM-C-His)
PV107505 500 ng

OR52A4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal MHC Class II Antibody (HIS19)
NBP2-00462 0.1 mg

Mouse Monoclonal MHC Class II Antibody (HIS19)

Sign In for Pricing
View Details
ESRRA Antibody
OAGA02688-100UL 100 µL

ESRRA Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Karyopherin Alpha 1 (KPNa1)
MBS2075224-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Karyopherin Alpha 1 (KPNa1)

Sign In for Pricing
View Details