Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNAT Peptide - middle region

NNAT Peptide - middle region

Product Specifications

Product Name Alternative

MGC1439, Peg5

UniProt

Q16517

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NNAT Rabbit Polyclonal Antibody (orb325280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859017

Preservative

Lyophilized powder

AA Sequence

MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Voltage-Gated Channel Subfamily A Member 1 (KCNA1) Antibody
abx331792 100 µL

Potassium Voltage-Gated Channel Subfamily A Member 1 (KCNA1) Antibody

Sign In for Pricing
View Details
KLKB1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
25844154 3x 1.0 µg DNA

KLKB1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
SR-B1 CRISPR Activation Plasmid (h)
sc-400990-ACT 20 µg

SR-B1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RGD1311564 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6028305 3x 1.0 µg

RGD1311564 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
GEMIN2 Rabbit pAb
MBS8545156-01 0.1 mL

GEMIN2 Rabbit pAb

Sign In for Pricing
View Details
GEMIN2 Rabbit pAb
MBS8545156-02 0.1 mL (AF405L)

GEMIN2 Rabbit pAb

Sign In for Pricing
View Details