Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nobox Peptide - middle region

Nobox Peptide - middle region

Product Specifications

Product Name Alternative

OG2, Og2x

UniProt

Q8VIH1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nobox Rabbit Polyclonal Antibody (orb576310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570939

Preservative

Lyophilized powder

AA Sequence

ETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R, 2S, 5S)-tert-Butyl Edoxaban
TRC-E480510-50MG 50 mg

(1R, 2S, 5S)-tert-Butyl Edoxaban

Sign In for Pricing
View Details
Tstd2 Mouse Gene Knockout Kit (CRISPR)
KN518387 1 Kit

Tstd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BTBD2 Human Gene Knockout Kit (CRISPR)
KN415487 1 Kit

BTBD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), 0.2mg/mL
BNUB1830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), 0.2mg/mL

Sign In for Pricing
View Details
LTK Rabbit Monoclonal Antibody [Clone ID: R02-8A4]
TA421720 100 µL

LTK Rabbit Monoclonal Antibody [Clone ID: R02-8A4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507122 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details