Nobox Peptide - middle region
Nobox Peptide - middle region
Product Specifications
Product Name Alternative
OG2, Og2x
UniProt
Q8VIH1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nobox Rabbit Polyclonal Antibody (orb576310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_570939
Preservative
Lyophilized powder
AA Sequence
ETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPML
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043433-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401883 20 µg
PKC eta (PRKCH) (NM_006255) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC472137-100 1x 100 µL
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details