Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSIP Peptide - middle region

NOSIP Peptide - middle region

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOSIP Rabbit Polyclonal Antibody (orb330895) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057037

Preservative

Lyophilized powder

AA Sequence

VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 (2H12/4), CF640R conjugate, 0.1mg/mL
BNC402178-100 1x 100 µL

DMC1 (2H12/4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Microplate Shaker BSTH-111
BSTH-111 1 Unit

Microplate Shaker BSTH-111

Sign In for Pricing
View Details
2-Nitro-m-toluic Acid
TRC-N572300-50G 50 g

2-Nitro-m-toluic Acid

Sign In for Pricing
View Details
1-(3-Pyridyl)-1,4-butanediol
TRC-P992500-5MG 5 mg

1-(3-Pyridyl)-1,4-butanediol

Sign In for Pricing
View Details
4-Formylbenzenesulfonic Acid Hydrate
TRC-F754732-10MG 10 mg

4-Formylbenzenesulfonic Acid Hydrate

Sign In for Pricing
View Details
APOD Polyclonal Antibody
E-AB-17730-01 20 µL

APOD Polyclonal Antibody

Sign In for Pricing
View Details