Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSIP Peptide - middle region

NOSIP Peptide - middle region

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOSIP Rabbit Polyclonal Antibody (orb330895) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057037

Preservative

Lyophilized powder

AA Sequence

VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 750 maleimide
1068-AAT 1 mg

IFluor® 750 maleimide

Sign In for Pricing
View Details
Tbx10 Mouse Gene Knockout Kit (CRISPR)
KN517284 1 Kit

Tbx10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zotepine S-Oxide
TRC-Z700910-5MG 5 mg

Zotepine S-Oxide

Sign In for Pricing
View Details
Gasdermin like (GSDMB) (NM_001165958) Human Over-expression Lysate
LC431358 20 µg

Gasdermin like (GSDMB) (NM_001165958) Human Over-expression Lysate

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF568 conjugate, 0.1mg/mL
BNC681176-100 1x 100 µL

EMI1 (EMI1/1176), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF809264 100 µg

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details