Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noto Peptide - N-terminal region

Noto Peptide - N-terminal region

Product Specifications

Product Name Alternative

Flh, MmNot, Not, tc

UniProt

A8MTQ0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Noto Rabbit Polyclonal Antibody (orb576103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007473

Preservative

Lyophilized powder

AA Sequence

VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-3,4,4a,5,6,10b-Hexahydro-2H-naphtho[1,2-b][1,4]oxazin-9-ol Hydrochloride
TRC-H294075-2.5MG 2.5 mg

(+)-3,4,4a,5,6,10b-Hexahydro-2H-naphtho[1,2-b][1,4]oxazin-9-ol Hydrochloride

Sign In for Pricing
View Details
Human EFCAB8 activation kit by CRISPRa
GA118000 1 Kit

Human EFCAB8 activation kit by CRISPRa

Sign In for Pricing
View Details
CLN5 Human Gene Knockout Kit (CRISPR)
KN214709RB 1 Kit

CLN5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TFP-N-sucDf-Fe
TRC-T497710-100MG 100 mg

TFP-N-sucDf-Fe

Sign In for Pricing
View Details
Human IgA Immunoglobulin (IA761), Biotin conjugate, 0.1mg/mL
BNCB0761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details