Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noto Peptide - N-terminal region

Noto Peptide - N-terminal region

Product Specifications

Product Name Alternative

Flh, MmNot, Not, tc

UniProt

A8MTQ0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Noto Rabbit Polyclonal Antibody (orb576103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007473

Preservative

Lyophilized powder

AA Sequence

VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone (6-5E-10B), CF640R conjugate, 0.1mg/mL
BNC400237-100 1x 100 µL

Progesterone (6-5E-10B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509089 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS702347 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tssk4 Rabbit Polyclonal Antibody
TA363411 100 µL

Tssk4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF440 activation kit by CRISPRa
GA114913 1 Kit

Human ZNF440 activation kit by CRISPRa

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details