Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Npas2 Peptide - N-terminal region

Npas2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC129355, MOP4, bHLHe9

UniProt

P97460

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Npas2 Rabbit Polyclonal Antibody (orb576449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032745

Preservative

Lyophilized powder

AA Sequence

PSPQRLDLDKASKKFPGSLPCQAGSAEPAGAGAGAPAAMLSDADAGDTFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51Q1 Rabbit Polyclonal Antibody
orb1880684-01 30 µL

OR51Q1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR51Q1 Rabbit Polyclonal Antibody
orb1880684-02 50 µL

OR51Q1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR51Q1 Rabbit Polyclonal Antibody
orb1880684-03 100 µL

OR51Q1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR51Q1 Rabbit Polyclonal Antibody
orb1880684-04 200 µL

OR51Q1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKAP9 Human siRNA Oligo Duplex (Locus ID 10142)
SR323007 1 Kit

AKAP9 Human siRNA Oligo Duplex (Locus ID 10142)

Sign In for Pricing
View Details
NLGN1 Antibody, HRP conjugated
A63344-100UG 100 µg

NLGN1 Antibody, HRP conjugated

Sign In for Pricing
View Details