Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Npas2 Peptide - N-terminal region

Npas2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC129355, MOP4, bHLHe9

UniProt

P97460

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Npas2 Rabbit Polyclonal Antibody (orb576449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032745

Preservative

Lyophilized powder

AA Sequence

PSPQRLDLDKASKKFPGSLPCQAGSAEPAGAGAGAPAAMLSDADAGDTFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat SEPP1 (Selenoprotein P) ELISA Kit
RE3119R-01 48 Tests

Rat SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
Rat SEPP1 (Selenoprotein P) ELISA Kit
RE3119R-02 96 Tests

Rat SEPP1 (Selenoprotein P) ELISA Kit

Sign In for Pricing
View Details
βB2-crystallin Double Nickase Plasmid (m)
sc-419826-NIC 20 µg

βB2-crystallin Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Pglyrp3b 3'UTR Luciferase Stable Cell Line
TU216137 1.0 mL

Pglyrp3b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
VIP (guinea pig)
orb3053976-01 25 mg

VIP (guinea pig)

Sign In for Pricing
View Details
VIP (guinea pig)
orb3053976-02 50 mg

VIP (guinea pig)

Sign In for Pricing
View Details