Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Npas2 Peptide - N-terminal region

Npas2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC129355, MOP4, bHLHe9

UniProt

P97460

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Npas2 Rabbit Polyclonal Antibody (orb576449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032745

Preservative

Lyophilized powder

AA Sequence

PSPQRLDLDKASKKFPGSLPCQAGSAEPAGAGAGAPAAMLSDADAGDTFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF601P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
51657111 3x 1.0 µg

ZNF601P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Ac-Met-AMC
4028557.005 50 mg

Ac-Met-AMC

Sign In for Pricing
View Details
SLC38A1 Recombinant Protein (Mouse)
RP173042 100 µg

SLC38A1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
STAC3 Protein Vector (Human) (pPM-C-His)
PV040368 500 ng

STAC3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Adapter for 0.4 mL microcentrifuge tubesset of 6
E5425717008 6 / PCK

Adapter for 0.4 mL microcentrifuge tubesset of 6

Sign In for Pricing
View Details
Phenol discontinued
462388-01 5 g

Phenol discontinued

Sign In for Pricing
View Details